General Information

  • ID:  hor004601
  • Uniprot ID:  Q9DET5
  • Protein name:  Thymosin beta-15A homolog
  • Gene name:  NA
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization
  • GO CC:  GO:0005737 cytoplasm; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  CDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSS
  • Length:  44(2-45)
  • Propeptide:  MCDKPDLSEVEKFDKKKLKKTNTEEKNTLPSKETIEQEKECVKSS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9DET5-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004601_AF2.pdbhor004601_ESM.pdb

Physical Information

Mass: 588092 Formula: C218H368N58O78S2
Absent amino acids: AGHMRWY Common amino acids: K
pI: 6.58 Basic residues: 11
Polar residues: 12 Hydrophobic residues: 7
Hydrophobicity: -156.82 Boman Index: -15109
Half-Life / Aliphatic Index: 1.2 hour Aliphatic Index: 48.64
Instability Index: 5418.86 Extinction Coefficient cystines: 125
Absorbance 280nm: 2.91

Literature

  • PubMed ID:  NA
  • Title:  NA